PDB entry 3ko7

View 3ko7 on RCSB PDB site
Description: DTD from Plasmodium falciparum in complex with D-Lysine
Class: hydrolase
Keywords: DTD, DEACYLASE, D-AMINO ACID, D-LYSINE, Hydrolase
Deposited on 2009-11-13, released 2009-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.226
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko7a_
  • Chain 'B':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko7b_
  • Chain 'C':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko7c_
  • Chain 'D':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko7d_
  • Chain 'E':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko7e_
  • Chain 'F':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko7f_
  • Heterogens: DLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ko7A (A:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko7A (A:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ko7B (B:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko7B (B:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ko7C (C:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko7C (C:)
    mrvviqrvkgailsvrleiiseiknglicflgihkndtwedalyiirkclnlrlwnndnk
    twdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyndd
    kikigkfgnymnidvtndgpvtiyidthdin
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ko7D (D:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko7D (D:)
    mrvviqrvkgailsvrkleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
    ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
    dkikigkfgnymnidvtndgpvtiyidthd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ko7E (E:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko7E (E:)
    mrvviqrvkgailsvrleiiseiknglicflgihkndtwedalyiirkclnlrlwnndnk
    twdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyndd
    kikigkfgnymnidvtndgpvtiyidthd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ko7F (F:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko7F (F:)
    mrvviqrvkgailsvrleiiseiknglicflgihkndtwedalyiirkclnlrlwnndnk
    twdknvkdlnyellivsqftlfpdfhlakepnealifynkiidefkkqynddkikigkfg
    nymnidvtndgpvtiyidthdi