PDB entry 3ko5

View 3ko5 on RCSB PDB site
Description: D-Tyr-tRNA(Tyr) deacylase from Plasmodium falciparum in complex with ADP
Class: hydrolase
Keywords: DTD, ADP, Deacylase, Hydrolase
Deposited on 2009-11-13, released 2009-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ko5a_
  • Chain 'B':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ko5b_
  • Chain 'C':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ko5c_
  • Chain 'D':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ko5d_
  • Chain 'E':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ko5e_
  • Chain 'F':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: dtd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ko5f_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ko5A (A:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko5A (A:)
    mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd
    nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn
    ddkikigkfgnymnidvtndgpvtiyidthdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ko5B (B:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko5B (B:)
    mrvviqrvkgailsvrkkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnn
    dnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqy
    nddkikigkfgnymnidvtndgpvtiyidthdin
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ko5C (C:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko5C (C:)
    mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd
    nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn
    ddkikigkfgnymnidvtndgpvtiyidthdinln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ko5D (D:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko5D (D:)
    mrvviqrvkgailsvreleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
    ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
    dkikigkfgnymnidvtndgpvtiyidthdin
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ko5E (E:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko5E (E:)
    mrvviqrvkgailsvrkkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnn
    dnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqy
    nddkikigkfgnymnidvtndgpvtiyidthdi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ko5F (F:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko5F (F:)
    mrvviqrvkgailsvrkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnnd
    nktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyn
    ddkikigkfgnymnidvtndgpvtiyidthdinl