PDB entry 3ko0

View 3ko0 on RCSB PDB site
Description: Structure of the tfp-ca2+-bound activated form of the s100a4 Metastasis factor
Class: metal binding protein
Keywords: mts1, s100a4, tfp, ca2+, oligomerization, Acetylation, Calcium, METAL BINDING PROTEIN
Deposited on 2009-11-12, released 2010-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0a_
  • Chain 'B':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0b_
  • Chain 'C':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0c_
  • Chain 'D':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0d_
  • Chain 'E':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0e_
  • Chain 'F':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0f_
  • Chain 'G':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0g_
  • Chain 'H':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0h_
  • Chain 'I':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0i_
  • Chain 'J':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0j_
  • Chain 'K':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0k_
  • Chain 'L':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0l_
  • Chain 'M':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0m_
  • Chain 'N':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0n_
  • Chain 'O':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0o_
  • Chain 'P':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0p_
  • Chain 'Q':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0q_
  • Chain 'R':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0r_
  • Chain 'S':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0s_
  • Chain 'T':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ko0t_
  • Heterogens: TFP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ko0A (A:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0A (A:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ko0B (B:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0B (B:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ko0C (C:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0C (C:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ko0D (D:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0D (D:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ko0E (E:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0E (E:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ko0F (F:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0F (F:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgdeaafqklmsnlds
    nrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ko0G (G:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0G (G:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkeaafqklmsnlds
    nrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ko0H (H:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0H (H:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ko0I (I:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0I (I:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ko0J (J:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0J (J:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ko0K (K:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0K (K:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ko0L (L:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0L (L:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3ko0M (M:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0M (M:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegf
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3ko0N (N:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0N (N:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegf
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3ko0O (O:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0O (O:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3ko0P (P:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0P (P:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegf
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3ko0Q (Q:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0Q (Q:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgafqklmsnldsnrd
    nevdfqeycvflsciammcneffegfpd
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3ko0R (R:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0R (R:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3ko0S (S:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0S (S:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3ko0T (T:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ko0T (T:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp