PDB entry 3kmt

View 3kmt on RCSB PDB site
Description: Crystal structure of vSET/SAH/H3 ternary complex
Class: viral protein
Keywords: SET domain, ternary complex, VIRAL PROTEIN
Deposited on 2009-11-11, released 2010-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.196
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: A612L protein
  Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O41094 (0-118)
  Domains in SCOPe 2.04: d3kmta_
• Chain 'B':
  Compound: A612L protein
  Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O41094 (0-118)
  Domains in SCOPe 2.04: d3kmtb_
• Chain 'C':
  Compound: A612L protein
  Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O41094 (0-118)
  Domains in SCOPe 2.04: d3kmtc_
• Chain 'G':
  Compound: histone h3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68431 (0-7)
• Chain 'H':
  Compound: histone h3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68431 (0-7)
• Chain 'I':
  Compound: histone h3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68431 (0-7)
• Heterogens: SAH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kmtA (A:)
  mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
  algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kmtB (B:)
  mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
  algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kmtC (C:)
  mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
  algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.