PDB entry 3kmt
View 3kmt on RCSB PDB site
Description: Crystal structure of vSET/SAH/H3 ternary complex
Class: viral protein
Keywords: SET domain, ternary complex, VIRAL PROTEIN
Deposited on
2009-11-11, released
2010-11-10
The last revision prior to the SCOPe 2.02 freeze date was dated
2010-11-10, with a file datestamp of
2010-11-05.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.196
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: A612L protein
Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3kmta_ - Chain 'B':
Compound: A612L protein
Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3kmtb_ - Chain 'C':
Compound: A612L protein
Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3kmtc_ - Chain 'G':
Compound: histone h3
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: histone h3
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: histone h3
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Heterogens: SAH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3kmtA (A:)
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3kmtB (B:)
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3kmtC (C:)
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.