PDB entry 3kmt

View 3kmt on RCSB PDB site
Description: Crystal structure of vSET/SAH/H3 ternary complex
Class: viral protein
Keywords: SET domain, ternary complex, VIRAL PROTEIN
Deposited on 2009-11-11, released 2010-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.196
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A612L protein
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kmta_
  • Chain 'B':
    Compound: A612L protein
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kmtb_
  • Chain 'C':
    Compound: A612L protein
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kmtc_
  • Chain 'G':
    Compound: histone h3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: histone h3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: histone h3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kmtA (A:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kmtB (B:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kmtC (C:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.