PDB entry 3kmn

View 3kmn on RCSB PDB site
Description: Crystal Structure of the Human Apo GST Pi C47S/Y108V Double Mutant
Class: transferase
Keywords: transferase, glutathione, detoxification, double mutant, ethacrynic acid, diuretic drug, dimer interface
Deposited on 2009-11-11, released 2010-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase P
    Species: Homo sapiens [TaxId:9606]
    Gene: FAEES3, GST3, GSTP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (46)
      • engineered (107)
    Domains in SCOPe 2.08: d3kmna1, d3kmna2
  • Chain 'B':
    Compound: Glutathione S-transferase P
    Species: Homo sapiens [TaxId:9606]
    Gene: FAEES3, GST3, GSTP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (46)
      • engineered (107)
    Domains in SCOPe 2.08: d3kmnb1, d3kmnb2
  • Heterogens: CA, CO3, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kmnA (A:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasslygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kmnB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasslygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq