PDB entry 3kmm

View 3kmm on RCSB PDB site
Description: Structure of human LCK kinase with a small molecule inhibitor
Class: transferase/transferase inhibitor
Keywords: TYROSINE KINASE, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Transferase, Tyrosine-protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2009-11-10, released 2010-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.167
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kmma_
  • Heterogens: LHL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kmmA (A:)
    mhhhhhhpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsms
    pdaflaeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinkl
    ldmaaqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregak
    fpikwtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvr
    pdncpeelyqlmrlcwkerpedrptfdylrsvledfftategqfqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kmmA (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledfftat