PDB entry 3kma

View 3kma on RCSB PDB site
Description: Crystal Structure of vSET under Condition A
Class: viral protein
Keywords: SET domain, VIRAL PROTEIN
Deposited on 2009-11-10, released 2010-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.234
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A612L protein
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kmaa_
  • Chain 'B':
    Compound: A612L protein
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kmab_
  • Heterogens: GOL, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kmaA (A:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kmaA (A:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kmaB (B:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kmaB (B:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisy