PDB entry 3kld

View 3kld on RCSB PDB site
Description: PTPRG CNTN4 complex
Class: cell adhesion
Keywords: CELL ADHESION, PROTEIN COMPLEX, RECEPTOR PROTEIN TYROSINE PHOSPHATASE, NEURAL RECOGNITION MOLECULE, Glycoprotein, Membrane, Phosphoprotein, Protein phosphatase, Transmembrane
Deposited on 2009-11-07, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Contactin 4
    Species: Mus musculus [TaxId:10090]
    Gene: Cntn4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14BL8 (4-End)
      • expression tag (2-3)
  • Chain 'B':
    Compound: Receptor-type tyrosine-protein phosphatase gamma
    Species: Mus musculus [TaxId:10090]
    Gene: PTPRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kldb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kldB (B:)
    gpgsgdpywaysgaygpehwvtssvscggshqspidildhharvgdeyqelqldgfdnes
    snktwmkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsvngrrfp
    vemqiffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheket
    fldpfilrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftte
    qqdhvksveylrnnfrpqqalndrvvsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kldB (B:)
    gdpywaysgaygpehwvtssvscggshqspidildhharvyqelqldgfdnessnktwmk
    ntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsvngrrfpvemqiff
    ynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpfil
    rdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhvks
    veylrnnfrpqqalndrvvsks