PDB entry 3kko

View 3kko on RCSB PDB site
Description: Crystal structure of M-Ras P40D/D41E/L51R in complex with GppNHp
Class: signaling protein
Keywords: GTP-binding, GTPase, SIGNALING PROTEIN
Deposited on 2009-11-06, released 2010-06-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein M-Ras
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08989 (Start-182)
      • engineered mutation (44-45)
      • engineered mutation (55)
    Domains in SCOPe 2.01: d3kkoa_
  • Chain 'B':
    Compound: Ras-related protein M-Ras
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08989 (Start-182)
      • engineered mutation (44-45)
      • engineered mutation (55)
    Domains in SCOPe 2.01: d3kkob_
  • Chain 'P':
    Compound: Ras-related protein M-Ras
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08989 (Start-182)
      • engineered mutation (44-45)
      • engineered mutation (55)
    Domains in SCOPe 2.01: d3kkop_
  • Heterogens: GNP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kkoA (A:)
    gplgsmatsavpsenlptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhte
    idnqwaildvldtagqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkd
    resfpmilvankvdlmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvi
    rqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkoA (A:)
    nlptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhteidnqwaildvldta
    gqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvd
    lmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kkoB (B:)
    gplgsmatsavpsenlptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhte
    idnqwaildvldtagqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkd
    resfpmilvankvdlmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvi
    rqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkoB (B:)
    nlptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhteidnqwaildvldta
    gqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvd
    lmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3kkoP (P:)
    gplgsmatsavpsenlptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhte
    idnqwaildvldtagqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkd
    resfpmilvankvdlmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvi
    rqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkoP (P:)
    lptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhteidnqwaildvldtag
    qeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdl
    mhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq