PDB entry 3kka

View 3kka on RCSB PDB site
Description: Co-crystal structure of the sam domains of EPHA1 AND EPHA2
Class: transferase
Keywords: ATP-BINDING, KINASE, NUCLEOTIDE-BINDING, RECEPTOR, TRANSFERASE, TYROSINE-PROTEIN KINASE, SIGNAL, STERILE ALPHA MOTIF, STRUCTURAL GENOMICS CONSORTIUM, SGC,GLYCOPROTEIN, MEMBRANE, PHOSPHOPROTEIN, POLYMORPHISM, TRANSMEMBRANE, Cataract
Deposited on 2009-11-05, released 2009-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-24, with a file datestamp of 2009-11-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPH, EPHA1, EPHT, EPHT1, MGC163163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkaa_
  • Chain 'B':
    Compound: Ephrin type-A receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPH, EPHA1, EPHT, EPHT1, MGC163163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkab_
  • Chain 'C':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EphA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkac_
  • Chain 'D':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EphA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkad_
  • Chain 'E':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EphA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkae_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kkaA (A:)
    mhhhhhhssgrenlyfqgdgipyrtvsewlesirmkryilhfhsagldtmecvleltaed
    ltqmgitlpghqkrilcsiqgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkaA (A:)
    dgipyrtvsewlesirmkryilhfhsagldtmecvleltaedltqmgitlpghqkrilcs
    iqgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kkaB (B:)
    mhhhhhhssgrenlyfqgdgipyrtvsewlesirmkryilhfhsagldtmecvleltaed
    ltqmgitlpghqkrilcsiqgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkaB (B:)
    gipyrtvsewlesirmkryilhfhsagldtmecvleltaedltqmgitlpghqkrilcsi
    qgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kkaC (C:)
    mhhhhhhssgrenlyfqgvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddik
    rigvrlpghqkriaysllglkdqvnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkaC (C:)
    tvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysllglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kkaD (D:)
    mhhhhhhssgrenlyfqgvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddik
    rigvrlpghqkriaysllglkdqvnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkaD (D:)
    gvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysl
    lglkdqvn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kkaE (E:)
    mhhhhhhssgrenlyfqgvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddik
    rigvrlpghqkriaysllglkdqvnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kkaE (E:)
    gvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysl
    lglkdq