PDB entry 3kiv

View 3kiv on RCSB PDB site
Description: recombinant kringle iv-10/m66 variant of human apolipoprotein(a)
Deposited on 1998-09-08, released 1999-05-18
The last revision prior to the SCOP 1.67 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d3kiv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kiv_ (-)
    qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
    wcfttdpsirweycnltrc