PDB entry 3kin

View 3kin on RCSB PDB site
Description: kinesin (dimeric) from rattus norvegicus
Class: motor protein
Keywords: motor protein, cytoskeleton
Deposited on 1997-08-25, released 1998-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.289
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KIN (0-237)
    Domains in SCOPe 2.03: d3kin.1
  • Chain 'B':
    Compound: kinesin heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KIN (0-114)
    Domains in SCOPe 2.03: d3kin.1
  • Chain 'C':
    Compound: kinesin heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KIN (0-237)
    Domains in SCOPe 2.03: d3kin.2
  • Chain 'D':
    Compound: kinesin heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KIN (0-114)
    Domains in SCOPe 2.03: d3kin.2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kinA (A:)
    adpaecsikvmcrfrplneaeilrgdkfipkfkgeetvvigqgkpyvfdrvlppnttqeq
    vynacakqivkdvlegyngtifaygqtssgkthtmegklhdpqlmgiipriahdifdhiy
    smdenlefhikvsyfeiyldkirdlldvsktnlavhedknrvpyvkgcterfvsspeevm
    dvidegkanrhvavtnmnehssrshsiflinikqenvetekklsgklylvdlagsekv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kinB (B:)
    nkslsalgnvisalaegtkthvpyrdskmtrilqdslggncrttiviccspsvfneaetk
    stlmfgqraktikntvsvnleltaeewkkkyekekeknkalksviqhlevelnrwrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kinC (C:)
    adpaecsikvmcrfrplneaeilrgdkfipkfkgeetvvigqgkpyvfdrvlppnttqeq
    vynacakqivkdvlegyngtifaygqtssgkthtmegklhdpqlmgiipriahdifdhiy
    smdenlefhikvsyfeiyldkirdlldvsktnlavhedknrvpyvkgcterfvsspeevm
    dvidegkanrhvavtnmnehssrshsiflinikqenvetekklsgklylvdlagsekv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kinD (D:)
    nkslsalgnvisalaegtkthvpyrdskmtrilqdslggncrttiviccspsvfneaetk
    stlmfgqraktikntvsvnleltaeewkkkyekekeknkalksviqhlevelnrwrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kinD (D:)
    nkslsalgnvisalaegtkthvpyrdskmtrilqdslggncrttiviccspsvfneaetk
    stlmfgqraktikntvsvnleltaeewkkkyekekeknkalksviqhlevelnrw