PDB entry 3kie

View 3kie on RCSB PDB site
Description: Crystal structure of adeno-associated virus serotype 3B
Class: virus
Keywords: Virus, capsid, parvovirus, icosahedral virus, beta barrel, single-stranded, dependovirus
Deposited on 2009-11-01, released 2010-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiea_
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kieb_
  • Chain 'C':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiec_
  • Chain 'D':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kied_
  • Chain 'E':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiee_
  • Chain 'F':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kief_
  • Chain 'G':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kieg_
  • Chain 'H':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kieh_
  • Chain 'I':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiei_
  • Chain 'J':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiej_
  • Chain 'K':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiek_
  • Chain 'L':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiel_
  • Chain 'M':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiem_
  • Chain 'N':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kien_
  • Chain 'O':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kieo_
  • Chain 'P':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiep_
  • Chain 'Q':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kieq_
  • Chain 'R':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kier_
  • Chain 'S':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kies_
  • Chain 'T':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kiet_
  • Heterogens: D5M

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kieA (A:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieA (A:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kieB (B:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieB (B:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kieC (C:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieC (C:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kieD (D:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieD (D:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kieE (E:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieE (E:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3kieF (F:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieF (F:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3kieG (G:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieG (G:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3kieH (H:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieH (H:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3kieI (I:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieI (I:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3kieJ (J:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieJ (J:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3kieK (K:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieK (K:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3kieL (L:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieL (L:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3kieM (M:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieM (M:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3kieN (N:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieN (N:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3kieO (O:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieO (O:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3kieP (P:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieP (P:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3kieQ (Q:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieQ (Q:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3kieR (R:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieR (R:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3kieS (S:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieS (S:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3kieT (T:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kieT (T:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl