PDB entry 3kic

View 3kic on RCSB PDB site
Description: Crystal structure of adeno-associated virus serotype 3B
Class: virus
Keywords: Virus, capsid, parvovirus, icosahedral virus, beta barrel, single-stranded, dependovirus
Deposited on 2009-11-01, released 2010-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kica_
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicb_
  • Chain 'C':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicc_
  • Chain 'D':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicd_
  • Chain 'E':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kice_
  • Chain 'F':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicf_
  • Chain 'G':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicg_
  • Chain 'H':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kich_
  • Chain 'I':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kici_
  • Chain 'J':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicj_
  • Chain 'K':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kick_
  • Chain 'L':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicl_
  • Chain 'M':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicm_
  • Chain 'N':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicn_
  • Chain 'O':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kico_
  • Chain 'P':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicp_
  • Chain 'Q':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicq_
  • Chain 'R':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kicr_
  • Chain 'S':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kics_
  • Chain 'T':
    Compound: Capsid protein VP1
    Species: Adeno-associated virus 3B [TaxId:68742]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3kict_
  • Heterogens: D5M

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kicA (A:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicA (A:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kicB (B:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicB (B:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kicC (C:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicC (C:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kicD (D:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicD (D:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kicE (E:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicE (E:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3kicF (F:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicF (F:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3kicG (G:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicG (G:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3kicH (H:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicH (H:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3kicI (I:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicI (I:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3kicJ (J:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicJ (J:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3kicK (K:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicK (K:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3kicL (L:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicL (L:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3kicM (M:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicM (M:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3kicN (N:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicN (N:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3kicO (O:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicO (O:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3kicP (P:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicP (P:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3kicQ (Q:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicQ (Q:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3kicR (R:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicR (R:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3kicS (S:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicS (S:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3kicT (T:)
    maadgylpdwlednlsegirewwalkpgvpqpkanqqhqdnrrglvlpgykylgpgngld
    kgepvneadaaalehdkaydqqlkagdnpylkynhadaefqerlqedtsfggnlgravfq
    akkrileplglveeaaktapgkkrpvdqspqepdsssgvgksgkqparkrlnfgqtgdse
    svpdpqplgeppaaptslgsntmasgggapmadnnegadgvgnssgnwhcdsqwlgdrvi
    ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli
    nnnwgfrpkklsfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg
    clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqfsytfedvpf
    hssyahsqsldrlmnplidqylyylnrtqgttsgttnqsrllfsqagpqsmslqarnwlp
    gpcyrqqrlsktandnnnsnfpwtaaskyhlngrdslvnpgpamashkddeekffpmhgn
    lifgkegttasnaeldnvmitdeeeirttnpvateqygtvannlqssntapttrtvndqg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglkhpppqimikntpvpanppt
    tfspakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngv
    yseprpigtryltrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kicT (T:)
    gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
    nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
    lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
    ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
    peiqytsnynksvnvdftvdtngvyseprpigtryltrnl