PDB entry 3khm

View 3khm on RCSB PDB site
Description: Crystal structure of sterol 14alpha-demethylase (CYP51) from Trypanosoma cruzi in complex with inhibitor fluconazole
Class: oxidoreductase
Keywords: sterol 14-alpha demethylase, cyp51, cytochrome p450, heme, oxidoreductase, monooxygenase, endoplasmic reticulum, transmembrane protein, sterol biosynthesis, lipids, membrane, iron, heme thiolate protein
Deposited on 2009-10-30, released 2009-11-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sterol 14 alpha-demethylase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: cyp51
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5I4E1 (0-End)
      • engineered (0-7)
    Domains in SCOPe 2.03: d3khma_
  • Heterogens: HEM, TPF

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3khmA (A:)
    ktsgkgklppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdp
    hehsrffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfv
    paiqhevrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllsk
    messlipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllg
    gllkavyrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkei
    defpaqlnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacs
    pllshhdeeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafrey
    dfqllrdevpdpdyhtmvvgptlnqclvkytrkkklpshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khmA (A:)
    ktsgkgklppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdp
    hehsrffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfv
    paiqhevrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllsk
    messlipallrlplpqsarcrearaelqkilgeiivareksdllggllkavyrdgtrmsl
    hevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnvmde
    mpfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafpnpr
    lwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdpdyh
    tmvvgptlnqclvkytrkkkl