PDB entry 3khj

View 3khj on RCSB PDB site
Description: C. parvum inosine monophosphate dehydrogenase bound by inhibitor C64
Class: oxidoreductase
Keywords: enzyme-inhibitor complex, Oxidoreductase
Deposited on 2009-10-30, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine-5-monophosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd6_20, GuaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CPK7 (Start-91)
      • linker (92-94)
    • Uniprot Q5CPK7 (95-End)
    Domains in SCOPe 2.07: d3khja_
  • Chain 'B':
    Compound: Inosine-5-monophosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd6_20, GuaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CPK7 (Start-91)
      • linker (92-94)
    • Uniprot Q5CPK7 (95-End)
    Domains in SCOPe 2.07: d3khjb_
  • Chain 'C':
    Compound: Inosine-5-monophosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd6_20, GuaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CPK7 (Start-91)
      • linker (92-94)
    • Uniprot Q5CPK7 (95-End)
    Domains in SCOPe 2.07: d3khjc_
  • Chain 'D':
    Compound: Inosine-5-monophosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd6_20, GuaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CPK7 (3-91)
      • linker (92-94)
    • Uniprot Q5CPK7 (95-End)
    Domains in SCOPe 2.07: d3khjd_
  • Chain 'E':
    Compound: Inosine-5-monophosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd6_20, GuaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CPK7 (Start-91)
      • linker (92-94)
    • Uniprot Q5CPK7 (95-End)
    Domains in SCOPe 2.07: d3khje_
  • Chain 'F':
    Compound: Inosine-5-monophosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd6_20, GuaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CPK7 (Start-91)
      • linker (92-94)
    • Uniprot Q5CPK7 (95-End)
    Domains in SCOPe 2.07: d3khjf_
  • Chain 'G':
    Compound: Inosine-5-monophosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd6_20, GuaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CPK7 (Start-91)
      • linker (92-94)
    • Uniprot Q5CPK7 (95-End)
    Domains in SCOPe 2.07: d3khjg_
  • Chain 'H':
    Compound: Inosine-5-monophosphate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd6_20, GuaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CPK7 (Start-91)
      • linker (92-94)
    • Uniprot Q5CPK7 (95-End)
    Domains in SCOPe 2.07: d3khjh_
  • Heterogens: IMP, C64, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3khjA (A:)
    gshmgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehl
    mavgmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdv
    ivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsic
    ttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsila
    gteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykg
    emegvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khjA (A:)
    tknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgm
    arlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivlds
    ahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttriv
    agvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagtees
    pgekeligdtvykyygrvkykgemegvvyqlvgglrscmgylgsasieelwkkssyveit
    ts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3khjB (B:)
    gshmgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehl
    mavgmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdv
    ivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsic
    ttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsila
    gteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykg
    emegvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khjB (B:)
    tknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgm
    arlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivlds
    ahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttriv
    agvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagtees
    pgekeligdtvykyyrgmgsvgamkmvpegiegrvkykgemegvvyqlvgglrscmgylg
    sasieelwkkssyveitt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3khjC (C:)
    gshmgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehl
    mavgmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdv
    ivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsic
    ttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsila
    gteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykg
    emegvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khjC (C:)
    tknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgm
    arlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivlds
    ahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttriv
    agvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagtees
    pgekeligdtvykyyrgiegrvkykgemegvvyqlvgglrscmgylgsasieelwkkssy
    veitts
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3khjD (D:)
    gshmgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehl
    mavgmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdv
    ivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsic
    ttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsila
    gteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykg
    emegvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khjD (D:)
    mgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmav
    gmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivl
    dsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttr
    ivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagte
    espgekeligdtvykyyrgmgsvgamksmvpegiegrvkykgemegvvyqlvgglrscmg
    ylgsasieelwkkssyveitt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3khjE (E:)
    gshmgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehl
    mavgmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdv
    ivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsic
    ttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsila
    gteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykg
    emegvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khjE (E:)
    gtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavg
    marlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivld
    sahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpcttrivag
    vgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagteespg
    ekeligdtvykyrvkykgemegvvyqlvgglrscmgylgsasieelwkkssyveitts
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3khjF (F:)
    gshmgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehl
    mavgmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdv
    ivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsic
    ttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsila
    gteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykg
    emegvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khjF (F:)
    tknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgm
    arlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivlds
    ahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttriv
    agvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagtees
    pgekeligdtvykyyrvkykgemegvvyqlvgglrscmgylgsasieelwkkssyveitt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3khjG (G:)
    gshmgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehl
    mavgmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdv
    ivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsic
    ttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsila
    gteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykg
    emegvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khjG (G:)
    tknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgm
    arlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivlds
    ahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgttrivagv
    gvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagteespge
    keligdtvykyyegrvkykgemegvvyqlvgglrscmgylgsasieelwkkssyveitts
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3khjH (H:)
    gshmgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehl
    mavgmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdv
    ivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsic
    ttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsila
    gteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykg
    emegvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khjH (H:)
    tknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgm
    arlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivlds
    ahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttriv
    agvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagtees
    pgekeligdtvykyyrgmgsvgamksgsgdryfqemvpegiegrvkykgemegvvyqlvg
    glrscmgylgsasieelwkkssyveitt