PDB entry 3khc

View 3khc on RCSB PDB site
Description: Crystal Structure of Escherichia coli AlkB in complex with ssDNA containing a 1-methylguanine lesion
Class: oxidoreductase/DNA
Keywords: oxidoreductase, 1-methylguanine, AlkB, 2-oxoglutarate, Dioxygenase, DNA damage, DNA repair, Iron, Metal-binding, oxidoreductase-DNA complex
Deposited on 2009-10-30, released 2010-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ketoglutarate-dependent dioxygenase AlkB
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: aidD, alkB, b2212, JW2200
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05050 (Start-218)
      • engineered (137)
    Domains in SCOPe 2.07: d3khca_
  • Chain 'B':
    Compound: Alpha-ketoglutarate-dependent dioxygenase AlkB
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: aidD, alkB, b2212, JW2200
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05050
      • engineered (137)
    Domains in SCOPe 2.07: d3khcb_
  • Chain 'C':
    Compound: DNA (5'-d(p*tp*ap*(mg1)p*tp*gp*cp*cp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(p*gp*cp*ap*t)-3')
  • Heterogens: CO, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3khcA (A:)
    gphmldlfadaepwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytm
    svamtncghlgwtthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdac
    linryapgaklslhqdkaepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvv
    wggesrlfyhgiqplkagfhpltidcrynltfrqagkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khcA (A:)
    pwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgw
    tthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgakls
    lhqdkaepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgi
    qplkagfhpltidcrynltfrqagkke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3khcB (B:)
    gphmldlfadaepwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytm
    svamtncghlgwtthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdac
    linryapgaklslhqdkaepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvv
    wggesrlfyhgiqplkagfhpltidcrynltfrqagkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3khcB (B:)
    epwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlg
    wtthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgakl
    slhqdkaepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhg
    iqplkagfhpltidcrynltfrqagkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.