PDB entry 3kgq

View 3kgq on RCSB PDB site
Description: Carboxypeptidase A liganded to an organic small-molecule: conformational changes
Class: hydrolase
Keywords: Intestinal protease, Zinc-Metallocarboxypeptidase-Citrate ternary complex, Carboxypeptidase, Hydrolase, Metal-binding, Metalloprotease
Deposited on 2009-10-29, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kgqa_
  • Heterogens: ZN, NA, CIT, ACN, FMT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kgqA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtlnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kgqA (A:)
    stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
    widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
    nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
    vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsykygs
    iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
    htl