PDB entry 3kgf

View 3kgf on RCSB PDB site
Description: The structure of 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase from Mycobacterium tuberculosis complexed with phenylalanine and tryptophan
Class: transferase
Keywords: Mycobacterium tuberculosis, DAH7P synthase, Shikimate pathway, Aromatic biosynthesis, Evolutionary relationships, Transferase, PHE+TRP-bound, Augmented TIM-barrel structure, Structural Genomics, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB
Deposited on 2009-10-29, released 2010-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2178c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kgfa_
  • Chain 'B':
    Compound: Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2178c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kgfb_
  • Heterogens: PHE, TRP, GOL, PO4, MN, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kgfA (A:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kgfA (A:)
    nwtvdipidpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvpseivr
    lqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvvkvar
    iagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnlvral
    tssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqtaeiyas
    healvldyeramlrlsdgpqlfdlsahtvwigertrqidgahiafaqvianpvgvklgpn
    mtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqviwqcdpmhg
    nthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvteclggaqdiset
    dlagryetacdprlntqqslelaflvaemlrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kgfB (B:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kgfB (B:)
    mnwtvdipilpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvpseiv
    rlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvvkva
    riagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnlvra
    ltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqtaeiya
    shealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvianpvgv
    klgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqviwqc
    dpmhgnthesfktrhfdrivdevqgffevhralgthpggihveitgenvteclggaqdis
    etdlagryetacdprlntqqslelaflvaemlrd