PDB entry 3kg2

View 3kg2 on RCSB PDB site
Description: AMPA subtype ionotropic glutamate receptor in complex with competitive antagonist ZK 200775
Class: membrane protein, transport protein
Keywords: ion channel, membrane protein, Cell membrane, Glycoprotein, Ion transport, Membrane, Postsynaptic cell membrane, Receptor, RNA editing, Synapse, Transmembrane, Transport, tetramer, transport protein
Deposited on 2009-10-28, released 2009-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-End)
      • engineered (231)
      • engineered (375)
      • engineered (382)
      • engineered (400)
      • engineered (403-404)
      • engineered (406)
      • variant (734-735)
      • variant (744)
    Domains in SCOPe 2.06: d3kg2a1, d3kg2a2, d3kg2a3
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-End)
      • engineered (231)
      • engineered (375)
      • engineered (382)
      • engineered (400)
      • engineered (403-404)
      • engineered (406)
      • variant (734-735)
      • variant (744)
    Domains in SCOPe 2.06: d3kg2b1, d3kg2b2, d3kg2b3
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-End)
      • engineered (231)
      • engineered (375)
      • engineered (382)
      • engineered (400)
      • engineered (403-404)
      • engineered (406)
      • variant (734-735)
      • variant (744)
    Domains in SCOPe 2.06: d3kg2c1, d3kg2c2, d3kg2c3
  • Chain 'D':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-End)
      • engineered (231)
      • engineered (375)
      • engineered (382)
      • engineered (400)
      • engineered (403-404)
      • engineered (406)
      • variant (734-735)
      • variant (744)
    Domains in SCOPe 2.06: d3kg2d1, d3kg2d2, d3kg2d3
  • Heterogens: ZK1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kg2A (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkanhaalagneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsrfspy
    ewhteefedgretqssestnefgifnslwfslgafmqqgadisprslsgrivggvwwfft
    liiissytanlaafltvermvspiesaedlskqteiaygtldsgstkeffrrskiavfdk
    mwtymrsaepsvfvrttaegvarvrkskgkyayllestmneyieqrkpcdtmkvggnlds
    kgygiatpkgsslgtpvnlavlklseqglldklknkwwydkgecgakdsgskektsalsl
    snvagvfyilvgglglamlvaliefcyksraeakrmkglvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kg2A (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkanhaalagneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvstnefg
    ifnslwfslgafmqprslsgrivggvwwfftliiissytanlaafltvermvspiesaed
    lskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskg
    kyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgl
    ldklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kg2B (B:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkanhaalagneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsrfspy
    ewhteefedgretqssestnefgifnslwfslgafmqqgadisprslsgrivggvwwfft
    liiissytanlaafltvermvspiesaedlskqteiaygtldsgstkeffrrskiavfdk
    mwtymrsaepsvfvrttaegvarvrkskgkyayllestmneyieqrkpcdtmkvggnlds
    kgygiatpkgsslgtpvnlavlklseqglldklknkwwydkgecgakdsgskektsalsl
    snvagvfyilvgglglamlvaliefcyksraeakrmkglvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kg2B (B:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkanhaalagneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvstnefg
    ifnslwfslgafmqprslsgrivggvwwfftliiissytanlaafltvermvspiesaed
    lskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskg
    kyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgl
    ldklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kg2C (C:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkanhaalagneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsrfspy
    ewhteefedgretqssestnefgifnslwfslgafmqqgadisprslsgrivggvwwfft
    liiissytanlaafltvermvspiesaedlskqteiaygtldsgstkeffrrskiavfdk
    mwtymrsaepsvfvrttaegvarvrkskgkyayllestmneyieqrkpcdtmkvggnlds
    kgygiatpkgsslgtpvnlavlklseqglldklknkwwydkgecgakdsgskektsalsl
    snvagvfyilvgglglamlvaliefcyksraeakrmkglvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kg2C (C:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkanhaalagneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvstnefg
    ifnslwfslgafmqprslsgrivggvwwfftliiissytanlaafltvermvspiesaed
    lskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskg
    kyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgl
    ldklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kg2D (D:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkanhaalagneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvsrfspy
    ewhteefedgretqssestnefgifnslwfslgafmqqgadisprslsgrivggvwwfft
    liiissytanlaafltvermvspiesaedlskqteiaygtldsgstkeffrrskiavfdk
    mwtymrsaepsvfvrttaegvarvrkskgkyayllestmneyieqrkpcdtmkvggnlds
    kgygiatpkgsslgtpvnlavlklseqglldklknkwwydkgecgakdsgskektsalsl
    snvagvfyilvgglglamlvaliefcyksraeakrmkglvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kg2D (D:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvlteddtsgleqktvvvttilespyvmmkanhaalagneryegycvdla
    aeiakhcgfkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevi
    dfskpfmslgisimikkpqkskpgvfsfldplayeiwmcivfayigvsvvlflvstnefg
    ifnslwfslgafmqprslsgrivggvwwfftliiissytanlaafltvermvspiesaed
    lskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskg
    kyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgl
    ldklknkwwydkgecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcyk