PDB entry 3kfy

View 3kfy on RCSB PDB site
Description: Dynamic switching and partial occupancies of a small molecule inhibitor complex of DHFR
Class: oxidoreductase
Keywords: small molecule inhibitor, dynamics, Antibiotic resistance, Methotrexate resistance, NADP, One-carbon metabolism, Oxidoreductase, Trimethoprim resistance
Deposited on 2009-10-28, released 2010-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ4 (0-158)
    • variant (36)
  Domains in SCOPe 2.08: d3kfya_
• Heterogens: NDP, JZM, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kfyA (A:)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr