PDB entry 3kfq

View 3kfq on RCSB PDB site
Description: Unreduced cathepsin V in complex with stefin A
Class: Hydrolase/Hydrolase inhibitor
Keywords: papain-like cysteine protease, cathepsin, protease-inhibitor complex, Hydrolase, Lysosome, Protease, Thiol protease, Zymogen, Protease inhibitor, Thiol protease inhibitor, Hydrolase-Hydrolase inhibitor complex
Deposited on 2009-10-27, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60911 (0-220)
      • engineered mutation (107)
      • engineered mutation (178)
    Domains in SCOPe 2.07: d3kfqa_
  • Chain 'B':
    Compound: Cathepsin L2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60911 (0-220)
      • engineered mutation (107)
      • engineered mutation (178)
    Domains in SCOPe 2.07: d3kfqb_
  • Chain 'C':
    Compound: Cystatin-A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kfqc_
  • Chain 'D':
    Compound: Cystatin-A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kfqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kfqA (A:)
    lpksvdwrkkgyvtpvknqkqcgscwafsatgalegqmfrktgklvslseqnlvdcsrpq
    gnqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgke
    kalmkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdn
    skywlvknswgpewgsngyvkiakdknnhcgiataasypnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kfqB (B:)
    lpksvdwrkkgyvtpvknqkqcgscwafsatgalegqmfrktgklvslseqnlvdcsrpq
    gnqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgke
    kalmkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdn
    skywlvknswgpewgsngyvkiakdknnhcgiataasypnv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kfqC (C:)
    mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
    dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kfqD (D:)
    mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
    dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf