PDB entry 3kfm

View 3kfm on RCSB PDB site
Description: Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with kainate
Class: transport protein
Keywords: GluA4, AMPA receptor, ligand-gated ion channel, ligand-binding domain, L651V, kainate, Alternative splicing, Cell junction, Cell membrane, Glycoprotein, Ion transport, Ionic channel, Lipoprotein, Membrane, Palmitate, Postsynaptic cell membrane, Receptor, Synapse, Transmembrane, Transport, TRANSPORT PROTEIN
Deposited on 2009-10-27, released 2010-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Glur4, Gria4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19493 (0-112)
      • linker (113-114)
      • engineered (133)
      • see remark 999 (226-228)
      • see remark 999 (237)
      • see remark 999 (239)
      • see remark 999 (241)
    • Uniprot P19493 (115-256)
    Domains in SCOPe 2.08: d3kfma_
  • Heterogens: KAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3kfmA (A:)
tvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkygar
dadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlakqteiaygtvdsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrks
kgkfafllestmneyteqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklsea
gvldklknkwwydkgec