PDB entry 3kfl

View 3kfl on RCSB PDB site
Description: Leishmania major methionyl-tRNA synthetase in complex with methionyladenylate and pyrophosphate
Class: ligase
Keywords: Leishmania, parasite, aminoacyl-tRNA synthetase, tRNA ligase, aaRS, MetRS, methionine, translation, ATP-binding, nucleotide-binding, Structural Genomics, MSGPP, Ligase, Medical Structural Genomics of Pathogenic Protozoa
Deposited on 2009-10-27, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase
    Species: Leishmania major [TaxId:5664]
    Gene: LmjF21.0810, MetRS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kfla1, d3kfla2
  • Heterogens: ME8, POP, MG, ZN, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kflA (A:)
    mahhhhhhmgtleaqtqgpgsmkkqkvffattpiyyvnasphighvystlivdvlgryhr
    vkgeevfvmtgtdehgqkvaeaaakqgvspmdfttsvssefkqcfqemnydmnyfirttn
    ptheklvqdiwkklaakgdiylgkyegwysvsdesfltaqnvadgvdrdgkpckvslesg
    hvvtwveeenymfrlsafrerllkyfhdhpncivpefrrreviktvekglfdlsisrkre
    svmnwsipvpgderhciyvwldalfnyytgaltrvatdgtetldedhhalnrwpadvhvv
    gkdilkfhaiywpaflmsaelplperlvshgwwtkdhkkiskslgnafdpvekakefgid
    alkyflmresnfqddgdysdknmvarlngeladtlgnlvsrcvapkinvngmwpepaeys
    esdktliaslnnlagtvdhyyclpdiqhaliaifdvlrslnayvtenapwklvkmdtarl
    gtvlyvtmeglrictmflqpvmpqkakeimdalgvpeaarvgmenylfgivkpgtkiagl
    aegqvvfqkvtlpteegersskgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kflA (A:)
    kqkvffattpiyyvnasphighvystlivdvlgryhrvkgeevfvmtgtdehgqkvaeaa
    akqgvspmdfttsvssefkqcfqemnydmnyfirttnptheklvqdiwkklaakgdiylg
    kyegwysvsdesfltaqnvadgvdrdgkpckvslesghvvtwveeenymfrlsafrerll
    kyfhdhpncivpefrrreviktvekglfdlsisrkresvmnwsipvpgderhciyvwlda
    lfnyytgaltrvatdgtetldedhhalnrwpadvhvvgkdilkfhaiywpaflmsaelpl
    perlvshgwwtkdhkkiskslgnafdpvekakefgidalkyflmresnfqddgdysdknm
    varlngeladtlgnlvsrcvapkinvngmwpepaeysesdktliaslnnlagtvdhyycl
    pdiqhaliaifdvlrslnayvtenapwklvkmdtarlgtvlyvtmeglrictmflqpvmp
    qkakeimdalgvpeaarvgmenylfgivkpgtkiaglaegqvvfqkvtlp