PDB entry 3kfi

View 3kfi on RCSB PDB site
Description: Major mouse urinary protein IV complexed with 2,5-dimethylpyrazine
Class: transport protein
Keywords: pheromone, major urinary protein, lipocalin, beta barrel, Disulfide bond, Pheromone-binding, Secreted, Transport, TRANSPORT PROTEIN
Deposited on 2009-10-27, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major urinary protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Mup4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kfia_
  • Heterogens: CL, 25R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kfiA (A:)
    eeatskgqnlnvekingewfsillasdkrekieehgsmrvfvehihvlenslafkfhtvi
    dgecseiflvadktekageysvmydgfntftilktdydnyimfhlinekdgktfqlmely
    grkadlnsdikekfvklceehgiikeniidltktnrclkare
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kfiA (A:)
    lnvekingewfsillasdkrekieehgsmrvfvehihvlenslafkfhtvidgecseifl
    vadktekageysvmydgfntftilktdydnyimfhlinekdgktfqlmelygrkadlnsd
    ikekfvklceehgiikeniidltktnrclkar