PDB entry 3kfa

View 3kfa on RCSB PDB site
Description: Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl purine template
Class: transferase
Keywords: Abl, CML, drug resistance, inhibitor, ATP-binding, Kinase, Nucleotide-binding, Oncogene, Tyrosine-protein kinase, TRANSFERASE
Deposited on 2009-10-27, released 2009-12-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.187
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl, Abl1, c-Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d3kfaa_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl, Abl1, c-Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d3kfab_
  • Heterogens: B91, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kfaA (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kfaA (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kfaB (B:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kfaB (B:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg