PDB entry 3kf4

View 3kf4 on RCSB PDB site
Description: Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl purine template
Class: transferase
Keywords: Abl, CML, drug resistance, inhibitor, ATP-binding, Kinase, Nucleotide-binding, Oncogene, Tyrosine-protein kinase, TRANSFERASE
Deposited on 2009-10-27, released 2009-12-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl, Abl1, c-Abl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3kf4a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl, Abl1, c-Abl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3kf4b_
  • Heterogens: B90, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kf4A (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kf4A (A:)
    spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkveeflkeaavmkei
    khpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissamey
    lekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslay
    nkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmr
    acwqwnpsdrpsfaeihqafetmfqessisdevekelgkrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kf4B (B:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kf4B (B:)
    spnydkwemertditmkhklgggqygevyegvwkkysltvavktltmeveeflkeaavmk
    eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
    eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
    aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
    mracwqwnpsdrpsfaeihqafetmfqess