PDB entry 3kf1

View 3kf1 on RCSB PDB site
Description: HIV Protease (PR) dimer without inhibitor; acetate in exo site
Class: hydrolase
Keywords: HIV-1, PROTEASE, EXO SITE, Aspartyl protease, HYDROLASE
Deposited on 2009-10-27, released 2010-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.182
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q903N5 (0-98)
    • engineered (6)
  Domains in SCOPe 2.08: d3kf1a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q903N5 (0-98)
    • engineered (6)
  Domains in SCOPe 2.08: d3kf1b_
• Heterogens: ACT, BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kf1A (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kf1B (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf