PDB entry 3kf0

View 3kf0 on RCSB PDB site
Description: HIV Protease with fragment 4D9 bound
Class: hydrolase/hydrolase inhibitor
Keywords: Protease, TL-3 inhibitor, fragment hit, Aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2009-10-27, released 2010-02-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q903N5 (0-98)
    • engineered (6)
  Domains in SCOPe 2.01: d3kf0a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q903N5 (0-98)
    • engineered (6)
  Domains in SCOPe 2.01: d3kf0b_
• Heterogens: 3TL, 4DX, DMS, K, BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kf0A (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kf0B (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf