PDB entry 3kds

View 3kds on RCSB PDB site
Description: apo-FtsH crystal structure
Class: metal binding protein
Keywords: Met-turn, beta roll, METAL BINDING PROTEIN
Deposited on 2009-10-23, released 2009-12-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Gene: FtsH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ49
      • engineered (61)
      • engineered (264)
      • engineered (269)
    Domains in SCOPe 2.03: d3kdse1, d3kdse2
  • Chain 'F':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Gene: FtsH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ49
      • engineered (61)
      • engineered (264)
      • engineered (269)
    Domains in SCOPe 2.03: d3kdsf1, d3kdsf2
  • Chain 'G':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Gene: FtsH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ49
      • engineered (61)
      • engineered (264)
      • engineered (269)
    Domains in SCOPe 2.03: d3kdsg1, d3kdsg2
  • Heterogens: ZN, NHX

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kdsE (E:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gatllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdsE (E:)
    krvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgatllarava
    geanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhdereqtl
    nqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkileiht
    rnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrviag
    parksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedk
    ylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgpl
    awgkrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleketiegde
    lrrilse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3kdsF (F:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gatllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdsF (F:)
    krvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgatllarava
    geanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhdereqtl
    nqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkileiht
    rnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrviag
    parksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedk
    ylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgpl
    awgklrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleketiegdel
    rrilse
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3kdsG (G:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gatllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdsG (G:)
    krvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgatllarava
    geanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhdereqtl
    nqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkileiht
    rnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrviag
    parksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedk
    ylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgpl
    awgklrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleketiegdel
    rrilse