SCOPe 2.05: Structural Classification of Proteins

PDB entry 3kdo

View 3kdo on RCSB PDB site
Description: Crystal structure of Type III Rubisco SP6 mutant complexed with 2-CABP
Class: lyase
Keywords: ribulose-1,5-bisphosphate carboxylase/oxygenase, Rubisco, Carbon dioxide fixation, Lyase, Magnesium, Metal-binding, Monooxygenase
Deposited on 2009-10-23, released 2010-10-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.221
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdoa1, d3kdoa2
Chain 'B':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdob1, d3kdob2
Chain 'C':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdoc1, d3kdoc2
Chain 'D':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdod1, d3kdod2
Chain 'E':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdoe1, d3kdoe2
Chain 'F':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdof1, d3kdof2
Chain 'G':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdog1, d3kdog2
Chain 'H':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdoh1, d3kdoh2
Chain 'I':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdoi1, d3kdoi2
Chain 'J':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-335)
Domains in SCOPe 2.05: d3kdoj1, d3kdoj2
Heterogens: CAP, MG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3kdoA (A:)
mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
laklyrligidqlhvgtagagklegerditlgfvdllreshykpdendvfhleqkfysik
aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
ldeyakthkelaralekwghvtpv