SCOPe 2.07: Structural Classification of Proteins

PDB entry 3kdn

View 3kdn on RCSB PDB site
Description: Crystal structure of Type III Rubisco SP4 mutant complexed with 2-CABP
Class: lyase
Keywords: ribulose-1,5-bisphosphate carboxylase/oxygenase, Rubisco, Carbon dioxide fixation, Lyase, Magnesium, Metal-binding, Monooxygenase
Deposited on 2009-10-23, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdna1, d3kdna2
Chain 'B':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdnb1, d3kdnb2
Chain 'C':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdnc1, d3kdnc2
Chain 'D':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdnd1, d3kdnd2
Chain 'E':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdne1, d3kdne2
Chain 'F':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdnf1, d3kdnf2
Chain 'G':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdng1, d3kdng2
Chain 'H':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdnh1, d3kdnh2
Chain 'I':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdni1, d3kdni2
Chain 'J':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakaraensis [TaxId:69014]
Gene: rbcL, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered (325-329)
Domains in SCOPe 2.07: d3kdnj1, d3kdnj2
Heterogens: MG, CAP, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3kdnA (A:)
mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfv
laklyrligidqlhvgtagagklegerditiqnarilreshykpdendvfhleqkfysik
aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
ldeyakthkelaralekwghvtpv