PDB entry 3kdm

View 3kdm on RCSB PDB site
Description: Crystal Structure of Human Anti-steroid Fab 5F2 in Complex with Testosterone
Class: immune system
Keywords: IMMUNE SYSTEM, Antibody, Immunoglobulin Fab fragment, Anti-steroid
Deposited on 2009-10-23, released 2010-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KDM (Start-217)
    Domains in SCOPe 2.06: d3kdma1, d3kdma2
  • Chain 'B':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KDM (0-End)
  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KDM (0-End)
  • Chain 'L':
    Compound: immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KDM (Start-217)
    Domains in SCOPe 2.06: d3kdml1, d3kdml2
  • Heterogens: TES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kdmA (A:)
    qsaltqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiygvtnrpsgv
    snrfsgsksgntasltisglqagdeadyycssytstrtpyvfgtgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdmA (A:)
    altqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiygvtnrpsgvsn
    rfsgsksgntasltisglqagdeadyycssytstrtpyvfgtgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3kdmL (L:)
    qsaltqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiygvtnrpsgv
    snrfsgsksgntasltisglqagdeadyycssytstrtpyvfgtgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kdmL (L:)
    altqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiygvtnrpsgvsn
    rfsgsksgntasltisglqagdeadyycssytstrtpyvfgtgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec