PDB entry 3kcw

View 3kcw on RCSB PDB site
Description: Crystal structure of Ganoderma fungal immunomodulatory protein, GMI
Class: immune system
Keywords: fniii, immune system
Deposited on 2009-10-22, released 2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunomodulatory protein
    Species: Ganoderma microsporum [TaxId:34462]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KCW
    Domains in SCOPe 2.08: d3kcwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kcwA (A:)
    msdtaliftlawnvkqlafdytpnwgrgrpssfidtvtfptvltdkaytyrvvvsgkdlg
    vrpsyavesdgsqkinfleynsgygiadtntiqvyvidpdtgnnfivaqwnyleqklise
    edlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kcwA (A:)
    sdtaliftlawnvkqlafdytpnwgrgrpssfidtvtfptvltdkaytyrvvvsgkdlgv
    rpsyavesdgsqkinfleynsgygiadtntiqvyvidpdtgnnfivaqwn