PDB entry 3kcs

View 3kcs on RCSB PDB site
Description: Crystal structure of PAmCherry1 in the dark state
Class: fluorescent protein
Keywords: fluorescent protein, photoconversion, chromophore structure, PALM
Deposited on 2009-10-21, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PAmCherry1 protein
    Species: Discosoma sp. [TaxId:86600]
    Gene: PAmCherry1
    Database cross-references and differences (RAF-indexed):
    • PDB 3KCS
    Domains in SCOPe 2.07: d3kcsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kcsA (A:)
    mvskgeednmaiikefmrfkvhmegsvnghvfeiegegegrpyegtqtaklkvtkggplp
    ftwdilspqfmygsnayvkhpadipdyfklsfpegfkwervmkfedggvvtvtqdsslqd
    gefiykvklrgtnfpsdgpvmqkktmgwealsermypedgalkgevkprvklkdgghyda
    evkttykakkpvqlpgaynvnrklditshnedytiveqyeraegrhstggmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kcsA (A:)
    aiikefmrfkvhmegsvnghvfeiegegegrpyegtqtaklkvtkggplpftwdilspqf
    mygsnayvkhpadipdyfklsfpegfkwervmkfedggvvtvtqdsslqdgefiykvklr
    gtnfpsdgpvmqkktmgwealsermypedgalkgevkprvklkdgghydaevkttykakk
    pvqlpgaynvnrklditshnedytiveqyeraegrhs