PDB entry 3kcp

View 3kcp on RCSB PDB site
Description: Crystal structure of interacting Clostridium thermocellum multimodular components
Class: structural protein
Keywords: Cohesin, Dockerin, X-module, Cellulosome, Carbohydrate metabolism, Cell wall biogenesis/degradation, Cellulose degradation, Glycoprotein, Polysaccharide degradation, Secreted, STRUCTURAL PROTEIN
Deposited on 2009-10-21, released 2010-02-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.206
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosomal-scaffolding protein A
    Species: Clostridium thermocellum ATCC 27405 [TaxId:203119]
    Gene: cipA, Cthe_3077
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cellulosome anchoring protein, cohesin region
    Species: Clostridium thermocellum ATCC 27405 [TaxId:203119]
    Gene: Cthe_1307, SdbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3kcpb_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3kcpB (B:)
mrgshhhhhhtdlradkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpk
vlmavdpetgkeftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyket
gvaeesgiiakigfkilqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvl
slgdepy

    Sequence, based on observed residues (ATOM records): (download) 
    >3kcpB (B:)
ssielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsstf
ppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkilq
kkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvls