PDB entry 3kcg

View 3kcg on RCSB PDB site
Description: Crystal structure of the antithrombin-factor IXa-pentasaccharide complex
Class: hydrolase, hydrolase inhibitor
Keywords: Michaelis complex, Blood coagulation, Calcium, Disulfide bond, EGF-like domain, Glycoprotein, Hemophilia, Hydrolase, Pharmaceutical, Protease, Secreted, Serine protease, Sulfation, Zymogen, Heparin-binding, Protease inhibitor, Serine protease inhibitor, Thrombophilia
Deposited on 2009-10-21, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Coagulation factor IXa heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (0-234)
      • engineered (184)
    Domains in SCOPe 2.07: d3kcgh_
  • Chain 'I':
    Compound: antithrombin-III
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINC1, AT3, PRO0309
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01008
      • engineered (136)
    Domains in SCOPe 2.07: d3kcgi_
  • Chain 'L':
    Compound: Coagulation factor IXa light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3kcgl_
  • Heterogens: CA, NTP, MPD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kcgH (H:)
    vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
    tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
    kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
    cqgdaggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3kcgI (I:)
    hgspvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfat
    tfyqhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqih
    fffaklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenae
    qsraainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfy
    kadgescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekelt
    pevlqewldeleemmlvvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrd
    dlyvsdafhkaflevneegseaaastavviagrslnpnrvtfkanrpflvfirevplnti
    ifmgrvanpcvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kcgI (I:)
    spvdictakprdipmnpmciyrspeqkipeatnrrvwelskansrfattfyqhladsknd
    ndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyr
    kankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsn
    ktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmm
    yqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldele
    emmlvvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkaf
    levneegseaaastavviagrslnpnrvtfkanrpflvfirevplntiifmgrvanpcv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3kcgL (L:)
    mdvtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kcgL (L:)
    mdvtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsv