PDB entry 3kbx

View 3kbx on RCSB PDB site
Description: Human macrophage inflammatory protein-1 alpha L3M_V63M
Class: cytokine
Keywords: chemokine, Chemotaxis, Inflammatory response, Secreted, CYTOKINE
Deposited on 2009-10-20, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.214
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ccl3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147
      • engineered (62)
    Domains in SCOPe 2.07: d3kbxa_
  • Chain 'B':
    Compound: ccl3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147
      • engineered (62)
    Domains in SCOPe 2.07: d3kbxb_
  • Chain 'C':
    Compound: ccl3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147
      • engineered (62)
    Domains in SCOPe 2.07: d3kbxc_
  • Chain 'D':
    Compound: ccl3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147
      • engineered (62)
    Domains in SCOPe 2.07: d3kbxd_
  • Chain 'E':
    Compound: ccl3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147
      • engineered (62)
    Domains in SCOPe 2.07: d3kbxe_
  • Heterogens: K, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kbxA (A:)
    asmaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kymsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbxA (A:)
    aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkym
    sdlels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kbxB (B:)
    asmaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kymsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbxB (B:)
    aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkym
    sdlels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kbxC (C:)
    asmaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kymsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbxC (C:)
    aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkym
    sdlels
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kbxD (D:)
    asmaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kymsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbxD (D:)
    aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkym
    sdlels
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kbxE (E:)
    asmaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kymsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbxE (E:)
    aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkym
    sdlels