PDB entry 3kbb

View 3kbb on RCSB PDB site
Description: Crystal structure of putative beta-phosphoglucomutase from Thermotoga maritima
Class: hydrolase
Keywords: hydrolase, arbohydrate metabolism, thermotoga maritima, cobalt, magnesium, manganese, metal-binding, nickel, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2009-10-20, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphorylated carbohydrates phosphatase TM_1254
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: bPGM, TM_1254
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kbba_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kbbA (A:)
    meavifdmdgvlmdteplyfeayrrvaesygkpytedlhrrimgvpereglpilmealei
    kdslenfkkrvheekkrvfsellkenpgvrealefvkskriklalatstpqrealerlrr
    ldlekyfdvmvfgdqvkngkpdpeiyllvlerlnvvpekvvvfedsksgveaaksagier
    iygvvhslndgkalleagavalvkpeeilnvlkevl