PDB entry 3kax

View 3kax on RCSB PDB site
Description: Crystal structure of a putative C-S lyase from Bacillus anthracis
Class: lyase
Keywords: PLP, Bacillus anthracis, C-S lyase, aminotransferase, Transferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, LYASE
Deposited on 2009-10-19, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase, classes I and II
    Species: Bacillus anthracis str. [TaxId:261594]
    Gene: BAS4776, BA_5138, GBAA5138, GBAA_5138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kaxa_
  • Chain 'B':
    Compound: Aminotransferase, classes I and II
    Species: Bacillus anthracis str. [TaxId:261594]
    Gene: BAS4776, BA_5138, GBAA5138, GBAA_5138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kaxb_
  • Heterogens: NA, PLP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kaxA (A:)
    mqlfhktvnrrgthsikwdtykneelihawiadmdfevpqpiqtalkkriehpifgytlp
    penigdiicnwtkkqynwdiqkewivfsagivpalstsiqaftkenesvlvqppiyppff
    emvttnnrqlcvsplqkqndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltk
    lgslctkynvivvadeihsdiiyadhthtpfaslseelaartitcmapsktfniaglqas
    iiiipneklrqaftsiqyrqgfhglnifaytamqsaytecndwlneirfyiednakface
    yikdhiptlsvmkpegsfllwidcsalnlsqdertklleekgkiivepgekyglggeehi
    ginigcprsvleeilnrlrhtfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kaxA (A:)
    dtykneelihawiadmdfevpqpiqtalkkriehpifgytlppenigdiicnwtkkqynw
    diqkewivfsagivpalstsiqaftkenesvlvqppiyppffemvttnnrqlcvsplqkq
    ndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltklgslctkynvivvadeih
    sdiiyadhthtpfaslseelaartitcmapsktfniaglqasiiiipneklrqaftsiqy
    rqgfhglnifaytamqsaytecndwlneirfyiednakfaceyikdhiptlsvmkpegsf
    llwidcsalnlsqdertklleekgkiivepgekyglggeehiginigcprsvleeilnrl
    rhtfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kaxB (B:)
    mqlfhktvnrrgthsikwdtykneelihawiadmdfevpqpiqtalkkriehpifgytlp
    penigdiicnwtkkqynwdiqkewivfsagivpalstsiqaftkenesvlvqppiyppff
    emvttnnrqlcvsplqkqndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltk
    lgslctkynvivvadeihsdiiyadhthtpfaslseelaartitcmapsktfniaglqas
    iiiipneklrqaftsiqyrqgfhglnifaytamqsaytecndwlneirfyiednakface
    yikdhiptlsvmkpegsfllwidcsalnlsqdertklleekgkiivepgekyglggeehi
    ginigcprsvleeilnrlrhtfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kaxB (B:)
    kwdtykneelihawiadmdfevpqpiqtalkkriehpifgytlppenigdiicnwtkkqy
    nwdiqkewivfsagivpalstsiqaftkenesvlvqppiyppffemvttnnrqlcvsplq
    kqndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltklgslctkynvivvade
    ihsdiiyadhthtpfaslseelaartitcmapsktfniaglqasiiiipneklrqaftsi
    qyrqgfhglnifaytamqsaytecndwlneirfyiednakfaceyikdhiptlsvmkpeg
    sfllwidcsalnlsqdertklleekgkiivepgekyglggeehiginigcprsvleeiln
    rlrhtfs