PDB entry 3kas

View 3kas on RCSB PDB site
Description: Machupo virus GP1 bound to human transferrin receptor 1
Class: viral protein/endocytosis
Keywords: Machupo virus, transferrin receptor 1, arenavirus, Cell membrane, Disulfide bond, Endocytosis, Glycoprotein, Host-virus interaction, Receptor, Secreted, Transmembrane, VIRAL PROTEIN-ENDOCYTOSIS complex
Deposited on 2009-10-19, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transferrin receptor protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02786 (0-End)
      • variant (21)
    Domains in SCOPe 2.07: d3kasa1, d3kasa2, d3kasa3
  • Chain 'B':
    Compound: Glycoprotein
    Species: Machupo virus [TaxId:11628]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, PO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kasA (A:)
    rlywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenqfrefklsk
    vwrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtk
    kdfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgh
    ahlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktd
    stcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksg
    vgtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaft
    yinldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldna
    afpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvik
    lthdvelnldyerynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdf
    gnaektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrk
    qnngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kasA (A:)
    rlywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenqfrefklsk
    vwrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtk
    kdfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgh
    ahlgtgdpytpgfpstqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstc
    rmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgvgt
    alllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaftyin
    ldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaafp
    flaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfviklth
    dvelnldyerynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgna
    ektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnn
    gafnetlfrnqlalatwtiqgaanalsgdvwdi
    

  • Chain 'B':
    No sequence available.