PDB entry 3kar

View 3kar on RCSB PDB site
Description: the motor domain of kinesin-like protein kar3, a saccharomyces cerevisiae kinesin-related protein
Deposited on 1997-11-26, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3kar__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >3kar_ (-)
    gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
    qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
    klktkgwdykvncefieiynenivdllrsdnnnkedtsiglkheirhdqetktttitnvt
    sckleseemveiilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnl
    vdlagserinvsqvvgdrlretqninkslsclgdvihalgqpdstkrhipfrnskltyll
    qysltgdsktlmfvnispssshinetlnslrfaskvns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kar_ (-)
    gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
    qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
    klktkgwdykvncefieiynenivdllrslkheirhdqetktttitnvtsckleseemve
    iilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnlvdlagserinv
    sdrlretqninkslsclgdvihalgqpdstkrhipfrnskltyllqysltgdsktlmfvn
    ispssshinetlnslrfaskvns