PDB entry 3kap

View 3kap on RCSB PDB site
Description: Flavodoxin from Desulfovibrio desulfuricans ATCC 27774 (oxidized form)
Class: electron transport
Keywords: flavodoxin, sulfate-reducing bacteria, Electron transport, Flavoprotein, FMN, Transport
Deposited on 2009-10-19, released 2009-11-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-11-24, with a file datestamp of 2009-11-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 [TaxId:525146]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3kapa_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3kapA (A:)
skvlilfgsstgntesiaqkleelvaagghevtllnaaeasadnladgydavlmgcsawg
medlelqddfaplfdemenmglkgkklaafasgdmeyehycgavpaieekarglgaevic
eglkiegdassdpdavsafaedvlkkl