PDB entry 3ka1

View 3ka1 on RCSB PDB site
Description: Crystal structure of RbcX from Thermosynechococcus elongatus
Class: chaperone
Keywords: chaperone, helix bundle, RuBisCO assembly
Deposited on 2009-10-17, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.183
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RbcX protein
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DIS6 (0-End)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d3ka1a_
  • Chain 'B':
    Compound: RbcX protein
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DIS6
      • engineered mutation (102)
    Domains in SCOPe 2.07: d3ka1b_
  • Heterogens: HEZ, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ka1A (A:)
    mdvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgeryleal
    freqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqlermtqvseanvens
    nletpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ka1A (A:)
    mdvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgeryleal
    freqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqlermtqvse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ka1B (B:)
    mdvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgeryleal
    freqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqlermtqvseanvens
    nletpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ka1B (B:)
    dvkhiakqttktlisyltyqavrtvigqlaetdpprslwlhqftsqesiqdgerylealf
    reqpdlgfriltvrehlaemvadylpemlragiqqanlqqraqqle