PDB entry 3k9s

View 3k9s on RCSB PDB site
Description: Crystal structure of the peroxide-bound manganese superoxide dismutase.
Class: Oxidoreductase
Keywords: Manganese superoxide dismutase, peroxide-bound, Manganese, Metal-binding, Oxidoreductase
Deposited on 2009-10-16, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.229
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b3908, JW3879, sodA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k9sa1, d3k9sa2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b3908, JW3879, sodA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k9sb1, d3k9sb2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn]
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b3908, JW3879, sodA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k9sc1, d3k9sc2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn]
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b3908, JW3879, sodA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k9sd1, d3k9sd2
  • Heterogens: MN, PEO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3k9sA (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3k9sB (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3k9sC (C:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3k9sD (D:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk