PDB entry 3k9l

View 3k9l on RCSB PDB site
Description: Allosteric modulation of H-Ras GTPase
Class: oncoprotein
Keywords: SWITCH I MUTANT, Cell membrane, Disease mutation, Golgi apparatus, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Palmitate, Prenylation, Proto-oncogene, S-nitrosylation, ONCOPROTEIN
Deposited on 2009-10-15, released 2010-11-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.221
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (31)
    Domains in SCOPe 2.01: d3k9la_
  • Chain 'B':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (31)
    Domains in SCOPe 2.01: d3k9lb_
  • Chain 'C':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (31)
    Domains in SCOPe 2.01: d3k9lc_
  • Heterogens: CA, MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k9lA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdefdptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k9lA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdefdptiedsyrkqvvidgetclldildtag
    qeeymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartves
    rqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k9lB (B:)
    mteyklvvvgaggvgksaltiqliqnhfvdefdptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k9lB (B:)
    mteyklvvvgaggvgksaltiqliqnhfvdefdptiedsyrkqvvidgetclldildtar
    dqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesr
    qaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k9lC (C:)
    mteyklvvvgaggvgksaltiqliqnhfvdefdptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k9lC (C:)
    mteyklvvvgaggvgksaltiqliqnhfvdefdptiedsyrkqvvidgetclldildtag
    dqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesr
    qaqdlarsygipyietsaktrqgvedafytlvreirqh