PDB entry 3k96

View 3k96 on RCSB PDB site
Description: 2.1 Angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsA) from Coxiella burnetii
Class: oxidoreductase
Keywords: glycerol-3-phosphate dehydrogenase, gpsA, idp01976, NAD, Oxidoreductase, Phospholipid biosynthesis, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2009-10-15, released 2009-10-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.167
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol-3-phosphate dehydrogenase [NAD(P)+]
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_1518, gpsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3k96a1, d3k96a2
  • Chain 'B':
    Compound: glycerol-3-phosphate dehydrogenase [NAD(P)+]
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_1518, gpsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3k96b1, d3k96b2
  • Heterogens: EPE, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k96A (A:)
    mhhhhhhssgvdlgtenlyfqsnamepfkhpiailgagswgtalalvlarkgqkvrlwsy
    esdhvdemqaegvnnrylpnypfpetlkaycdlkaslegvtdilivvpsfafhevitrmk
    plidaktriawgtkglakgsrllhevvatelgqvpmavisgpslatevaanlptavslas
    nnsqfskdlierlhgqrfrvyknddmigvelcgsvknilaiatgisdglklgsnaraali
    trgltemgrlvsvfggkqetltglaglgdlvltctdnqsrnrrfglalgegvdkkeaqqa
    igqaieglyntdqvhalaqkhaiempltfqvhrilhedldpqqavqellerspkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k96A (A:)
    pfkhpiailgagswgtalalvlarkgqkvrlwsyesdhvdemqaegvnnrylpnypfpet
    lkaycdlkaslegvtdilivvpsfafhevitrmkplidaktriawgtkglakgsrllhev
    vatelgqvpmavisgpslatevaanlptavslasnnsqfskdlierlhgqrfrvyknddm
    igvelcgsvknilaiatgisdglklgsnaraalitrgltemgrlvsvfggkqetltglag
    lgdlvltctdnqsrnrrfglalgegvdkkeaqqaigqaieglyntdqvhalaqkhaiemp
    ltfqvhrilhedldpqqavqellers
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k96B (B:)
    mhhhhhhssgvdlgtenlyfqsnamepfkhpiailgagswgtalalvlarkgqkvrlwsy
    esdhvdemqaegvnnrylpnypfpetlkaycdlkaslegvtdilivvpsfafhevitrmk
    plidaktriawgtkglakgsrllhevvatelgqvpmavisgpslatevaanlptavslas
    nnsqfskdlierlhgqrfrvyknddmigvelcgsvknilaiatgisdglklgsnaraali
    trgltemgrlvsvfggkqetltglaglgdlvltctdnqsrnrrfglalgegvdkkeaqqa
    igqaieglyntdqvhalaqkhaiempltfqvhrilhedldpqqavqellerspkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k96B (B:)
    pfkhpiailgagswgtalalvlarkgqkvrlwsyesdhvdemqaegvnnrylpnypfpet
    lkaycdlkaslegvtdilivvpsfafhevitrmkplidaktriawgtkglakgsrllhev
    vatelgqvpmavisgpslatevaanlptavslasnnsqfskdlierlhgqrfrvyknddm
    igvelcgsvknilaiatgisdglklgsnaraalitrgltemgrlvsvfggkqetltglag
    lgdlvltctdnqsrnrrfglalgegvdkkeaqqaigqaieglyntdqvhalaqkhaiemp
    ltfqvhrilhedldpqqavqeller