PDB entry 3k8x

View 3k8x on RCSB PDB site
Description: Crystal structure of the carboxyltransferase domain of acetyl-coenzyme A carboxylase in complex with tepraloxydim
Class: transferase
Keywords: TRANSFERASE, ACETYL-COA CARBOXYLASE, CARBOXYLTRANSFERASE, ACC, CT, tepraloxydim, ATP-binding, Biotin, Fatty acid biosynthesis, Ligase, Lipid synthesis, Manganese, Metal-binding, Multifunctional enzyme, Nucleotide-binding, Phosphoprotein
Deposited on 2009-10-15, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ACC1, ACETYL-COA CARBOXYLASE, FAS3, N3175, YNR016C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k8xa1, d3k8xa2
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ACC1, ACETYL-COA CARBOXYLASE, FAS3, N3175, YNR016C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k8xb1, d3k8xb2
  • Chain 'C':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ACC1, ACETYL-COA CARBOXYLASE, FAS3, N3175, YNR016C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k8xc1, d3k8xc2
  • Heterogens: B89, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k8xA (A:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8xA (A:)
    lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
    neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
    edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
    segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
    hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
    tqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptnde
    tydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtv
    enlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgg
    qrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvn
    aragvlepqgmvgikfrreklldtmnrlddkyrellpiygqislqfadlhdrssrmvakg
    viskelewtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdhed
    drqvatwieenyktlddklkglklesfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k8xB (B:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8xB (B:)
    lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
    neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
    edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
    segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
    hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
    tqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptnde
    tydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtv
    enlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgg
    qrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvn
    aragvlepqgmvgikfrreklldtmnrlddkyrellpiygqislqfadlhdrssrmvakg
    viskelewtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdhed
    drqvatwieenyktlddklkgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k8xC (C:)
    gsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltdd
    ffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigs
    fgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqy
    lyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagat
    srayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnl
    qlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftp
    tndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigve
    trtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrg
    fsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemy
    advnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskql
    adrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeyl
    ikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa
    qdlakkirsdhdnaidglsevikmlstddkekllktlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k8xC (C:)
    ewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengel
    teverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvtey
    arkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfd
    kensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtc
    rsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvsh
    ltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegr
    etesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanp
    nsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevlky
    gsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqgm
    vgikfrreklldtmnrlddkyrellpiygqislqfadlhdrssrmvakgviskelewtea
    rrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieen
    yktlddklkglkles